Total number of results for Physeter catodon are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02717 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Physeter catodon | Insulin | Insulin B chain | 13373434#Harris J.I., Sanger F., Naughton M.A.#Species differences in insulin.# Arch. Biochem. Biophys. 65:427-438(1956).$13552701#Ishihara Y., Saito T., Ito Y., Fujino M.#Structure of sperm- and sei-whale insulins and their breakdown by whale pepsin.#Nature 181:1468-1469(1958). | |
| NP02718 |
GIVEQCCTSICSLYQLENYCN
|
21 | Physeter catodon | Insulin | Insulin A chain | 13373434#Harris J.I., Sanger F., Naughton M.A.#Species differences in insulin.# Arch. Biochem. Biophys. 65:427-438(1956).$13552701#Ishihara Y., Saito T., Ito Y., Fujino M.#Structure of sperm- and sei-whale insulins and their breakdown by whale pepsin.#Nature 181:1468-1469(1958). |